SCOPe 2.07: Domain d3s7rb_: 3s7r B:

Lineage for d3s7rb_ (3s7r B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein automated matches [190332] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187155] (30 PDB entries)

8. Domain d3s7rb_: 3s7r B: [196248]
   automated match to d1hd0a_
   complexed with unl

Details for d3s7rb_

PDB Entry: 3s7r, 2.15 Å

PDB Description: crystal structure of a heterogeneous nuclear ribonucleoprotein a/b (hnrpab) from homo sapiens at 2.15 a resolution

PDB Compounds: (B:) Heterogeneous nuclear ribonucleoprotein A/B

SCOPe Domain Sequences for d3s7rb_:

Sequence; same for both SEQRES and ATOM records:

>d3s7rb_ d.58.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eedagkmfvgglswdtskkdlkdyftkfgevvdctikmdpntgrsrgfgfilfkdaasve
kvldqkehrldgrvidpkka

Timeline for d3s7rb_:

• d3s7rb_ first appeared in SCOPe 2.02
  
• d3s7rb_ appears in SCOPe 2.06
  
• d3s7rb_ appears in the current release, SCOPe 2.08