| Class b: All beta proteins [48724] (176 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
| Protein automated matches [190457] (8 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [189303] (23 PDB entries) |
| Domain d2xmfa_: 2xmf A: [196242] automated match to d2drka_ complexed with dia |
PDB Entry: 2xmf (more details), 1.5 Å
SCOPe Domain Sequences for d2xmfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xmfa_ b.34.2.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gplgspqckalyaydaqdtdelsfnandiidiikedpsgwwtgrlrgkqglfpnnyvtki
Timeline for d2xmfa_: