Lineage for d2xmfa_ (2xmf A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1120542Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1120633Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1120995Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 1120996Protein automated matches [190457] (5 species)
    not a true protein
  7. 1121037Species Mouse (Mus musculus) [TaxId:10090] [189303] (3 PDB entries)
  8. 1121038Domain d2xmfa_: 2xmf A: [196242]
    automated match to d2drka_
    complexed with dia

Details for d2xmfa_

PDB Entry: 2xmf (more details), 1.5 Å

PDB Description: myosin 1e sh3
PDB Compounds: (A:) myosin 1e sh3

SCOPe Domain Sequences for d2xmfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xmfa_ b.34.2.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gplgspqckalyaydaqdtdelsfnandiidiikedpsgwwtgrlrgkqglfpnnyvtki

SCOPe Domain Coordinates for d2xmfa_:

Click to download the PDB-style file with coordinates for d2xmfa_.
(The format of our PDB-style files is described here.)

Timeline for d2xmfa_: