Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (91 species) not a true protein |
Species Plesiocystis pacifica [TaxId:191768] [196240] (1 PDB entry) |
Domain d2xt0a_: 2xt0 A: [196241] automated match to d2pkyx_ complexed with so4 |
PDB Entry: 2xt0 (more details), 1.9 Å
SCOPe Domain Sequences for d2xt0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xt0a_ c.69.1.0 (A:) automated matches {Plesiocystis pacifica [TaxId: 191768]} mefvrtpddrfadlpdfpyaphyleglpgfeglrmhyvdegprdaehtflclhgepswsf lyrkmlpvftaaggrvvapdlfgfgrsdkptddavytfgfhrrsllafldalqlervtlv cqdwggilgltlpvdrpqlvdrlivmntalavglspgkgfeswrdfvanspdldvgklmq raipgitdaevaaydapfpgpefkagvrrfpaivpitpdmegaeigrqamsfwstqwsgp tfmavgaqdpvlgpevmgmlrqairgcpepmiveagghfvqehgepiaraalaafgq
Timeline for d2xt0a_: