Lineage for d2xt0a_ (2xt0 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2153248Species Plesiocystis pacifica [TaxId:191768] [196240] (1 PDB entry)
  8. 2153249Domain d2xt0a_: 2xt0 A: [196241]
    automated match to d2pkyx_
    complexed with so4

Details for d2xt0a_

PDB Entry: 2xt0 (more details), 1.9 Å

PDB Description: dehalogenase dppa from plesiocystis pacifica sir-i
PDB Compounds: (A:) haloalkane dehalogenase

SCOPe Domain Sequences for d2xt0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xt0a_ c.69.1.0 (A:) automated matches {Plesiocystis pacifica [TaxId: 191768]}
mefvrtpddrfadlpdfpyaphyleglpgfeglrmhyvdegprdaehtflclhgepswsf
lyrkmlpvftaaggrvvapdlfgfgrsdkptddavytfgfhrrsllafldalqlervtlv
cqdwggilgltlpvdrpqlvdrlivmntalavglspgkgfeswrdfvanspdldvgklmq
raipgitdaevaaydapfpgpefkagvrrfpaivpitpdmegaeigrqamsfwstqwsgp
tfmavgaqdpvlgpevmgmlrqairgcpepmiveagghfvqehgepiaraalaafgq

SCOPe Domain Coordinates for d2xt0a_:

Click to download the PDB-style file with coordinates for d2xt0a_.
(The format of our PDB-style files is described here.)

Timeline for d2xt0a_: