SCOPe 2.02: Domain d2xt0a_: 2xt0 A:

Lineage for d2xt0a_ (2xt0 A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (24 species)
   not a true protein

7. Species Plesiocystis pacifica [TaxId:191768] [196240] (1 PDB entry)

8. Domain d2xt0a_: 2xt0 A: [196241]
   automated match to d2pkyx_
   complexed with so4

Details for d2xt0a_

PDB Entry: 2xt0, 1.9 Å

PDB Description: dehalogenase dppa from plesiocystis pacifica sir-i

PDB Compounds: (A:) haloalkane dehalogenase

SCOPe Domain Sequences for d2xt0a_:

Sequence; same for both SEQRES and ATOM records:

>d2xt0a_ c.69.1.0 (A:) automated matches {Plesiocystis pacifica [TaxId: 191768]}
mefvrtpddrfadlpdfpyaphyleglpgfeglrmhyvdegprdaehtflclhgepswsf
lyrkmlpvftaaggrvvapdlfgfgrsdkptddavytfgfhrrsllafldalqlervtlv
cqdwggilgltlpvdrpqlvdrlivmntalavglspgkgfeswrdfvanspdldvgklmq
raipgitdaevaaydapfpgpefkagvrrfpaivpitpdmegaeigrqamsfwstqwsgp
tfmavgaqdpvlgpevmgmlrqairgcpepmiveagghfvqehgepiaraalaafgq

Timeline for d2xt0a_:

• d2xt0a_ is new in SCOPe 2.02-stable
  
• d2xt0a_ appears in SCOPe 2.03
  
• d2xt0a_ appears in the current release, SCOPe 2.08