Lineage for d1ffky_ (1ffk Y:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1750858Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 1750859Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
    automatically mapped to Pfam PF00832
  5. 1750860Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 1750861Protein Ribosomal protein L39e [48664] (1 species)
  7. 1750862Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
    Uniprot P22452
  8. 1750920Domain d1ffky_: 1ffk Y: [19624]
    Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffkz_
    complexed with cd, k, mg

Details for d1ffky_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
PDB Compounds: (Y:) ribosomal protein l39e

SCOPe Domain Sequences for d1ffky_:

Sequence, based on SEQRES records: (download)

>d1ffky_ a.137.1.1 (Y:) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrkakldnqnsrvpayvmlktdrevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d1ffky_ a.137.1.1 (Y:) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrkakldnqnsrvpayvmlktde

SCOPe Domain Coordinates for d1ffky_:

Click to download the PDB-style file with coordinates for d1ffky_.
(The format of our PDB-style files is described here.)

Timeline for d1ffky_: