SCOPe 2.06: Domain d2xuza1: 2xuz A:19-298

Lineage for d2xuza1 (2xuz A:19-298)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.4: TM0189-like [142789] (4 proteins)
   Part of Pfam PF01497 that include some other superfamily members

6. Protein automated matches [190559] (3 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [189053] (4 PDB entries)

8. Domain d2xuza1: 2xuz A:19-298 [196239]
   Other proteins in same PDB: d2xuza2
   automated match to d2whya_
   complexed with eb4, fe, peg, pg4, po4

Details for d2xuza1

PDB Entry: 2xuz, 1.9 Å

PDB Description: Crystal structure of the triscatecholate siderophore binding protein FeuA from Bacillus subtilis complexed with Ferri-Enterobactin

PDB Compounds: (A:) Iron-uptake system-binding protein

SCOPe Domain Sequences for d2xuza1:

Sequence; same for both SEQRES and ATOM records:

>d2xuza1 c.92.2.4 (A:19-298) automated matches {Bacillus subtilis [TaxId: 1423]}
kkkieyldktyevtvptdkiaitgsvesmedaklldvhpqgaisfsgkfpdmfkditdka
eptgekmepniekilemkpdvilastkfpektlqkistagttipvshissnwkenmmlla
qltgkekkakkiiadyeqdlketktkindkakdskalvirirqgniyiypeqvyfnstly
gdlglkapnevkaakaqelisleklsemnpdhifvqfsddenadkpdalkdleknpiwks
lkavkedhvyvnsvdplaqggtawskvrflkaaaekltqn

Timeline for d2xuza1:

• d2xuza1 first appeared in SCOPe 2.02, called d2xuza_
  
• d2xuza1 was called d2xuza_ in SCOPe 2.05
  
• d2xuza1 appears in SCOPe 2.07
  
• d2xuza1 appears in the current release, SCOPe 2.08