| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) ![]() contains a long alpha helical insertion in the interdomain linker |
| Family c.92.2.4: TM0189-like [142789] (4 proteins) Part of Pfam PF01497 that include some other superfamily members |
| Protein automated matches [190559] (2 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [189053] (4 PDB entries) |
| Domain d2xuza_: 2xuz A: [196239] automated match to d2whya_ complexed with eb4, fe, peg, pg4, po4 |
PDB Entry: 2xuz (more details), 1.9 Å
SCOPe Domain Sequences for d2xuza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xuza_ c.92.2.4 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
kkkieyldktyevtvptdkiaitgsvesmedaklldvhpqgaisfsgkfpdmfkditdka
eptgekmepniekilemkpdvilastkfpektlqkistagttipvshissnwkenmmlla
qltgkekkakkiiadyeqdlketktkindkakdskalvirirqgniyiypeqvyfnstly
gdlglkapnevkaakaqelisleklsemnpdhifvqfsddenadkpdalkdleknpiwks
lkavkedhvyvnsvdplaqggtawskvrflkaaaekltqnk
Timeline for d2xuza_: