Lineage for d3o6rb_ (3o6r B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2041484Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2042612Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2042613Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 2042624Protein Chlorocatechol 1,2-dioxygenase [110096] (1 species)
    similar overall structure to Catechol 1,2-dioxygenase
  7. 2042625Species Rhodococcus opacus [TaxId:37919] [110097] (5 PDB entries)
    Uniprot O67987
  8. 2042631Domain d3o6rb_: 3o6r B: [196233]
    automated match to d1s9aa_
    complexed with fe, myy, pyg

Details for d3o6rb_

PDB Entry: 3o6r (more details), 2.6 Å

PDB Description: crystal structure of 4-chlorocatechol dioxygenase from rhodococcus opacus 1cp in complex with pyrogallol
PDB Compounds: (B:) Chlorocatechol 1,2-dioxygenase

SCOPe Domain Sequences for d3o6rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o6rb_ b.3.6.1 (B:) Chlorocatechol 1,2-dioxygenase {Rhodococcus opacus [TaxId: 37919]}
antrvielfdeftdlirdfivrheittpeyetimqymisvgeagewplwldaffettvds
vsygkgnwtssaiqgpffkegaplltgkpatlpmradepgdrmrftgsvrdtsgtpitga
vidvwhstndgnysffspalpdqyllrgrvvpaedgsiefhsirpvpyeipkagptgqlm
nsylgrhswrpahihiritadgyrplitqlyfegdpyldsdscsavkselvlpvnkidid
getwqlvdfnfilqhn

SCOPe Domain Coordinates for d3o6rb_:

Click to download the PDB-style file with coordinates for d3o6rb_.
(The format of our PDB-style files is described here.)

Timeline for d3o6rb_: