| Class b: All beta proteins [48724] (180 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) ![]() |
| Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins) sandwich; 9 strands in 2 sheets |
| Protein Chlorocatechol 1,2-dioxygenase [110096] (1 species) similar overall structure to Catechol 1,2-dioxygenase |
| Species Rhodococcus opacus [TaxId:37919] [110097] (5 PDB entries) Uniprot O67987 |
| Domain d3o6rb_: 3o6r B: [196233] automated match to d1s9aa_ complexed with fe, myy, pyg |
PDB Entry: 3o6r (more details), 2.6 Å
SCOPe Domain Sequences for d3o6rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o6rb_ b.3.6.1 (B:) Chlorocatechol 1,2-dioxygenase {Rhodococcus opacus [TaxId: 37919]}
antrvielfdeftdlirdfivrheittpeyetimqymisvgeagewplwldaffettvds
vsygkgnwtssaiqgpffkegaplltgkpatlpmradepgdrmrftgsvrdtsgtpitga
vidvwhstndgnysffspalpdqyllrgrvvpaedgsiefhsirpvpyeipkagptgqlm
nsylgrhswrpahihiritadgyrplitqlyfegdpyldsdscsavkselvlpvnkidid
getwqlvdfnfilqhn
Timeline for d3o6rb_: