Lineage for d1dvoa_ (1dvo A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.136: Repressor of bacterial conjugation FinO [48656] (1 superfamily) Superfamily a.136.1: Repressor of bacterial conjugation FinO [48657] (1 family) 
Family a.136.1.1: Repressor of bacterial conjugation FinO [48658] (1 protein) Protein Repressor of bacterial conjugation FinO [48659] (1 species) Species Escherichia coli [TaxId:562] [48660] (1 PDB entry) 
Domain d1dvoa_: 1dvo A: [19623]
Details for d1dvoa_
PDB Entry: 1dvo (more details), 2 Å
PDB Description: the x-ray crystal structure of fino, a repressor of bacterial conjugation
SCOP Domain Sequences for d1dvoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dvoa_ a.136.1.1 (A:) Repressor of bacterial conjugation FinO {Escherichia coli}
ppkwkvkkqklaekaareaeltakkaqarqalsiylnlptldeavntlkpwwpglfdgdt
prllacgirdvlledvaqrniplshkklrramkaitrsesylcamkagacrydtegyvte
hisqeeevyaaerldkirrqnrikaelqavld
SCOP Domain Coordinates for d1dvoa_:
Click to download the PDB-style file with coordinates for d1dvoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dvoa_:
- d1dvoa_ appears in SCOP 1.57
- d1dvoa_ appears in the current release, SCOPe 2.08
View in 3D