Lineage for d1dvoa_ (1dvo A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733624Fold a.136: FinO-like [48656] (1 superfamily)
    6 helices: irregular non-globular array; also contains two small beta-hairpins
  4. 2733625Superfamily a.136.1: FinO-like [48657] (1 family) (S)
  5. 2733626Family a.136.1.1: FinO-like [48658] (2 proteins)
  6. 2733641Protein Repressor of bacterial conjugation FinO [48659] (1 species)
  7. 2733642Species Escherichia coli [TaxId:562] [48660] (1 PDB entry)
  8. 2733643Domain d1dvoa_: 1dvo A: [19623]

Details for d1dvoa_

PDB Entry: 1dvo (more details), 2 Å

PDB Description: the x-ray crystal structure of fino, a repressor of bacterial conjugation
PDB Compounds: (A:) fertility inhibition protein o

SCOPe Domain Sequences for d1dvoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dvoa_ a.136.1.1 (A:) Repressor of bacterial conjugation FinO {Escherichia coli [TaxId: 562]}
ppkwkvkkqklaekaareaeltakkaqarqalsiylnlptldeavntlkpwwpglfdgdt
prllacgirdvlledvaqrniplshkklrramkaitrsesylcamkagacrydtegyvte
hisqeeevyaaerldkirrqnrikaelqavld

SCOPe Domain Coordinates for d1dvoa_:

Click to download the PDB-style file with coordinates for d1dvoa_.
(The format of our PDB-style files is described here.)

Timeline for d1dvoa_: