![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.136: FinO-like [48656] (1 superfamily) 6 helices: irregular non-globular array; also contains two small beta-hairpins |
![]() | Superfamily a.136.1: FinO-like [48657] (1 family) ![]() |
![]() | Family a.136.1.1: FinO-like [48658] (2 proteins) |
![]() | Protein Repressor of bacterial conjugation FinO [48659] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [48660] (1 PDB entry) |
![]() | Domain d1dvoa_: 1dvo A: [19623] |
PDB Entry: 1dvo (more details), 2 Å
SCOPe Domain Sequences for d1dvoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dvoa_ a.136.1.1 (A:) Repressor of bacterial conjugation FinO {Escherichia coli [TaxId: 562]} ppkwkvkkqklaekaareaeltakkaqarqalsiylnlptldeavntlkpwwpglfdgdt prllacgirdvlledvaqrniplshkklrramkaitrsesylcamkagacrydtegyvte hisqeeevyaaerldkirrqnrikaelqavld
Timeline for d1dvoa_: