Class g: Small proteins [56992] (90 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins) |
Protein Vascular endothelial growth factor, VEGF [57505] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [57506] (17 PDB entries) Uniprot P15692 40-133 |
Domain d3s1bv_: 3s1b V: [196229] automated match to d1fltw_ |
PDB Entry: 3s1b (more details), 2.9 Å
SCOPe Domain Sequences for d3s1bv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s1bv_ g.17.1.1 (V:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]} hevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpt eesnitmqimrikphqgqhigemsflqhnkcecrpk
Timeline for d3s1bv_: