Lineage for d3t4cd1 (3t4c D:1-282)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086456Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2086457Protein automated matches [190115] (75 species)
    not a true protein
  7. 2086567Species Burkholderia ambifaria [TaxId:398577] [196224] (1 PDB entry)
  8. 2086571Domain d3t4cd1: 3t4c D:1-282 [196225]
    Other proteins in same PDB: d3t4ca2, d3t4cb2, d3t4cc2, d3t4cd2
    automated match to d3undb_

Details for d3t4cd1

PDB Entry: 3t4c (more details), 1.95 Å

PDB Description: Crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from Burkholderia ambifaria
PDB Compounds: (D:) 2-dehydro-3-deoxyphosphooctonate aldolase 1

SCOPe Domain Sequences for d3t4cd1:

Sequence, based on SEQRES records: (download)

>d3t4cd1 c.1.10.0 (D:1-282) automated matches {Burkholderia ambifaria [TaxId: 398577]}
mklydfevgldqpffliagtcvveseqmtidtagrlkeicaklnvpfiykssydkanrss
gksfrglgmdeglrilgevkrqlglpvltdvhsideieqvasvvdvlqtpaflcrqtdfi
hacarsgkpvnikkgqflaphdmknvidkareaareaglsedrfmacergvsfgynnlvs
dmrslaimretsapvvfdathsvqlpggqgtssggqrefvpvlaraavatgvaglfmeth
pnpaeaksdgpnavplnrmgalletlvtldqavkrhpflend

Sequence, based on observed residues (ATOM records): (download)

>d3t4cd1 c.1.10.0 (D:1-282) automated matches {Burkholderia ambifaria [TaxId: 398577]}
mklydfevgldqpffliagtcvveseqmtidtagrlkeicaklnvpfiykssmdeglril
gevkrqlglpvltdvhsideieqvasvvdvlqtpaflcrqtdfihacarsgkpvnikkgq
flaphdmknvidkareaareaglsedrfmacergvsfgynnlvsdmrslaimretsapvv
fdathsvqlpgqrefvpvlaraavatgvaglfmethpnpaeaksdgpnavplnrmgalle
tlvtldqavkrhpflend

SCOPe Domain Coordinates for d3t4cd1:

Click to download the PDB-style file with coordinates for d3t4cd1.
(The format of our PDB-style files is described here.)

Timeline for d3t4cd1: