SCOPe 2.02: Domain d3t4xb_: 3t4x B:

Lineage for d3t4xb_ (3t4x B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (73 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:1392] [196222] (1 PDB entry)

8. Domain d3t4xb_: 3t4x B: [196223]
   automated match to d2hq1a_

Details for d3t4xb_

PDB Entry: 3t4x, 2.8 Å

PDB Description: short chain dehydrogenase/reductase family oxidoreductase from bacillus anthracis str. ames ancestor

PDB Compounds: (B:) Oxidoreductase, short chain dehydrogenase/reductase family

SCOPe Domain Sequences for d3t4xb_:

Sequence; same for both SEQRES and ATOM records:

>d3t4xb_ c.2.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 1392]}
amhmqlkgktalvtgstagigkaiatslvaeganvlingrreenvnetikeiraqypdai
lqpvvadlgteqgcqdviekypkvdilinnlgifepveyfdipdedwfklfevnimsgvr
ltrsylkkmierkegrvifiaseaaimpsqemahysatktmqlslsrslaelttgtnvtv
ntimpgstltegvetmlnslypneqltieeaekrfmkenrptsiiqrlirpeeiahlvtf
lssplssaingsalridgglvrsvf

Timeline for d3t4xb_:

• d3t4xb_ is new in SCOPe 2.02-stable
  
• d3t4xb_ appears in SCOPe 2.03
  
• d3t4xb_ appears in the current release, SCOPe 2.08, called d3t4xb1