Lineage for d3t4xb1 (3t4x B:1-264)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2845909Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [196222] (3 PDB entries)
  8. 2845916Domain d3t4xb1: 3t4x B:1-264 [196223]
    Other proteins in same PDB: d3t4xa2, d3t4xb2
    automated match to d2hq1a_

Details for d3t4xb1

PDB Entry: 3t4x (more details), 2.8 Å

PDB Description: short chain dehydrogenase/reductase family oxidoreductase from bacillus anthracis str. ames ancestor
PDB Compounds: (B:) Oxidoreductase, short chain dehydrogenase/reductase family

SCOPe Domain Sequences for d3t4xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t4xb1 c.2.1.0 (B:1-264) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mhmqlkgktalvtgstagigkaiatslvaeganvlingrreenvnetikeiraqypdail
qpvvadlgteqgcqdviekypkvdilinnlgifepveyfdipdedwfklfevnimsgvrl
trsylkkmierkegrvifiaseaaimpsqemahysatktmqlslsrslaelttgtnvtvn
timpgstltegvetmlnslypneqltieeaekrfmkenrptsiiqrlirpeeiahlvtfl
ssplssaingsalridgglvrsvf

SCOPe Domain Coordinates for d3t4xb1:

Click to download the PDB-style file with coordinates for d3t4xb1.
(The format of our PDB-style files is described here.)

Timeline for d3t4xb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3t4xb2