Lineage for d1g8qb_ (1g8q B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733570Fold a.135: Tetraspanin [48651] (1 superfamily)
    5 helices: irregular disulfide-linked array; form homodimer
  4. 2733571Superfamily a.135.1: Tetraspanin [48652] (1 family) (S)
  5. 2733572Family a.135.1.1: Tetraspanin [48653] (2 proteins)
  6. 2733573Protein CD81 extracellular domain [48654] (1 species)
  7. 2733574Species Human (Homo sapiens) [TaxId:9606] [48655] (2 PDB entries)
  8. 2733576Domain d1g8qb_: 1g8q B: [19622]

Details for d1g8qb_

PDB Entry: 1g8q (more details), 1.6 Å

PDB Description: crystal structure of human cd81 extracellular domain, a receptor for hepatitis c virus
PDB Compounds: (B:) cd81 antigen, extracellular domain

SCOPe Domain Sequences for d1g8qb_:

Sequence, based on SEQRES records: (download)

>d1g8qb_ a.135.1.1 (B:) CD81 extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
fvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlkn
nlcpsgsniisnlfkedchqkiddlfsgkh

Sequence, based on observed residues (ATOM records): (download)

>d1g8qb_ a.135.1.1 (B:) CD81 extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
fvnkdqiakdvkqfydqalqqavvdnakavvktfhetldccgsstltalttsvlknnlcp
sgsniisnlfkedchqkiddlfsgkh

SCOPe Domain Coordinates for d1g8qb_:

Click to download the PDB-style file with coordinates for d1g8qb_.
(The format of our PDB-style files is described here.)

Timeline for d1g8qb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1g8qa_