SCOPe 2.06: Domain d3tc7a1: 3tc7 A:2-247

Lineage for d3tc7a1 (3tc7 A:2-247)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)

6. Protein automated matches [190053] (9 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:273057] [196207] (2 PDB entries)

8. Domain d3tc7a1: 3tc7 A:2-247 [196209]
   Other proteins in same PDB: d3tc7a2
   automated match to d3nz1a_
   complexed with acy, po4

Details for d3tc7a1

PDB Entry: 3tc7, 1.5 Å

PDB Description: Crystal Structure of Engineered Protein. Northeast Structural Genomics Consortium Target OR62.

PDB Compounds: (A:) indole-3-glycerol phosphate synthase

SCOPe Domain Sequences for d3tc7a1:

Sequence; same for both SEQRES and ATOM records:

>d3tc7a1 c.1.2.4 (A:2-247) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
prylkgwledvvqlslrrpsvrasrqrpiislnerilefnkrnitaiiaeykrkdpsgld
verdpieyakfmeryavglfisteekyfngsyetlrkiassvsipilmydfivkesqidd
aynlgadtvalivkiltereleslleyarsygmepliiindendldialrigarfigiaa
rdwetgeinkenqrklismipsnvvkvakegiserneieelrklgvnafligsslmrnpe
kikeli

Timeline for d3tc7a1:

• d3tc7a1 first appeared in SCOPe 2.02, called d3tc7a_
  
• d3tc7a1 was called d3tc7a_ in SCOPe 2.05
  
• d3tc7a1 appears in SCOPe 2.07
  
• d3tc7a1 appears in the current release, SCOPe 2.08