Lineage for d2yc3a_ (2yc3 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1868080Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1868081Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1868664Family c.68.1.13: Cytidylytransferase [68901] (7 protein domains)
  6. 1868665Protein 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) [64140] (4 species)
  7. 1868685Species Thale cress (Arabidopsis thaliana), chloroplast [TaxId:3702] [142690] (7 PDB entries)
    Uniprot P69834 75-300
  8. 1868686Domain d2yc3a_: 2yc3 A: [196204]
    automated match to d1w77a1
    complexed with cd, cu, mw5, na

Details for d2yc3a_

PDB Entry: 2yc3 (more details), 1.4 Å

PDB Description: inhibitors of the herbicidal target ispd
PDB Compounds: (A:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase, chloroplastic

SCOPe Domain Sequences for d2yc3a_:

Sequence, based on SEQRES records: (download)

>d2yc3a_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]}
meksvsvillaggqgkrmkmsmpkqyipllgqpialysfftfsrmpevkeivvvcdpffr
difeeyeesidvdlsfaipgkerqdsvysglqeidvnselvcihdsarplvntedvekvl
kdgsavgaavlgvpakatikevnsdslvvktldrktlwemqtpqvikpellkkgfelvks
eglevtddvsiveylkhpvyvsqgsytnikvttpddlllaerilse

Sequence, based on observed residues (ATOM records): (download)

>d2yc3a_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]}
meksvsvillaggqgpkqyipllgqpialysfftfsrmpevkeivvvcdpffrdifeeye
esidvdlsfaipgkerqdsvysglqeidvnselvcihdsarplvntedvekvlkdgsavg
aavlgvpakatikevnsdslvvktldrktlwemqtpqvikpellkkgfelvkseglevtd
dvsiveylkhpvyvsqgsytnikvttpddlllaerilse

SCOPe Domain Coordinates for d2yc3a_:

Click to download the PDB-style file with coordinates for d2yc3a_.
(The format of our PDB-style files is described here.)

Timeline for d2yc3a_: