Lineage for d2ycma_ (2ycm A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2898986Family c.68.1.13: Cytidylytransferase [68901] (7 proteins)
  6. 2899085Protein automated matches [190992] (6 species)
    not a true protein
  7. 2899101Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196202] (1 PDB entry)
  8. 2899102Domain d2ycma_: 2ycm A: [196203]
    automated match to d1w77a1
    complexed with 30a, cd, cu, na

Details for d2ycma_

PDB Entry: 2ycm (more details), 1.8 Å

PDB Description: inhibitors of herbicidal target ispd
PDB Compounds: (A:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase, chloroplastic

SCOPe Domain Sequences for d2ycma_:

Sequence, based on SEQRES records: (download)

>d2ycma_ c.68.1.13 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
eksvsvillaggqgkrmkmsmpkqyipllgqpialysfftfsrmpevkeivvvcdpffrd
ifeeyeesidvdlsfaipgkerqdsvysglqeidvnselvcihdsarplvntedvekvlk
dgsavgaavlgvpakatikevnsdslvvktldrktlwemqtpqvikpellkkgfelvkse
glevtddvsiveylkhpvyvsqgsytnikvttpddlllaerilse

Sequence, based on observed residues (ATOM records): (download)

>d2ycma_ c.68.1.13 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
eksvsvillagmpkqyipllgqpialysfftfsrmpevkeivvvcdpffrdifeeyeesi
dvdlsfaipgkerqdsvysglqeidvnselvcihdsarplvntedvekvlkdgsavgaav
lgvpakatikevnsdslvvktltlwemqtpqvikpellkkgfelvkseglevtddvsive
ylkhpvyvsqgsytnikvttpddlllaerilse

SCOPe Domain Coordinates for d2ycma_:

Click to download the PDB-style file with coordinates for d2ycma_.
(The format of our PDB-style files is described here.)

Timeline for d2ycma_: