SCOPe 2.07: Domain d3olwb_: 3olw B:

Lineage for d3olwb_ (3olw B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein CheY protein [52174] (5 species)

7. Species Escherichia coli [TaxId:562] [52175] (42 PDB entries)
   Uniprot P06143

8. Domain d3olwb_: 3olw B: [196198]
   automated match to d1djma_
   complexed with bef, cl, gol, mn, so4

Details for d3olwb_

PDB Entry: 3olw, 2.3 Å

PDB Description: structural and functional effects of substitution at position t+1 in chey: cheya88t-bef3-mn complex

PDB Compounds: (B:) Chemotaxis protein cheY

SCOPe Domain Sequences for d3olwb_:

Sequence; same for both SEQRES and ATOM records:

>d3olwb_ c.23.1.1 (B:) CheY protein {Escherichia coli [TaxId: 562]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
nmdglellktiradgamsalpvlmvtteakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

Timeline for d3olwb_:

• d3olwb_ first appeared in SCOPe 2.02
  
• d3olwb_ appears in SCOPe 2.06
  
• d3olwb_ appears in the current release, SCOPe 2.08