Lineage for d3olyb_ (3oly B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2463695Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2463696Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2463707Protein CheY protein [52174] (5 species)
  7. 2463708Species Escherichia coli [TaxId:562] [52175] (42 PDB entries)
    Uniprot P06143
  8. 2463761Domain d3olyb_: 3oly B: [196196]
    automated match to d1djma_
    complexed with bef, gol, mn, so4

Details for d3olyb_

PDB Entry: 3oly (more details), 2.05 Å

PDB Description: structural and functional effects of substitution at position t+1 in chey: cheya88m-bef3-mn complex
PDB Compounds: (B:) Chemotaxis protein cheY

SCOPe Domain Sequences for d3olyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3olyb_ c.23.1.1 (B:) CheY protein {Escherichia coli [TaxId: 562]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
nmdglellktiradgamsalpvlmvtmeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

SCOPe Domain Coordinates for d3olyb_:

Click to download the PDB-style file with coordinates for d3olyb_.
(The format of our PDB-style files is described here.)

Timeline for d3olyb_: