| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.1: CheY-related [52173] (26 proteins) |
| Protein CheY protein [52174] (5 species) |
| Species Escherichia coli [TaxId:562] [52175] (42 PDB entries) Uniprot P06143 |
| Domain d3olyb_: 3oly B: [196196] automated match to d1djma_ complexed with bef, gol, mn, so4 |
PDB Entry: 3oly (more details), 2.05 Å
SCOPe Domain Sequences for d3olyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3olyb_ c.23.1.1 (B:) CheY protein {Escherichia coli [TaxId: 562]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
nmdglellktiradgamsalpvlmvtmeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm
Timeline for d3olyb_: