| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.1: CheY-related [52173] (26 proteins) |
| Protein automated matches [190177] (7 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [195427] (6 PDB entries) |
| Domain d3oo0b_: 3oo0 B: [196195] automated match to d3myya_ complexed with gol, mn, nh4, so4 |
PDB Entry: 3oo0 (more details), 1.55 Å
SCOPe Domain Sequences for d3oo0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oo0b_ c.23.1.1 (B:) automated matches {Escherichia coli [TaxId: 83333]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftpatleekln
kifeklgm
Timeline for d3oo0b_: