Lineage for d3oo0b_ (3oo0 B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1158036Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1158037Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1158038Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 1158302Protein automated matches [190177] (7 species)
    not a true protein
  7. 1158334Species Escherichia coli [TaxId:83333] [195427] (6 PDB entries)
  8. 1158337Domain d3oo0b_: 3oo0 B: [196195]
    automated match to d3myya_
    complexed with gol, mn, nh4, so4

Details for d3oo0b_

PDB Entry: 3oo0 (more details), 1.55 Å

PDB Description: Structure of apo CheY A113P
PDB Compounds: (B:) Chemotaxis protein cheY

SCOPe Domain Sequences for d3oo0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oo0b_ c.23.1.1 (B:) automated matches {Escherichia coli [TaxId: 83333]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftpatleekln
kifeklgm

SCOPe Domain Coordinates for d3oo0b_:

Click to download the PDB-style file with coordinates for d3oo0b_.
(The format of our PDB-style files is described here.)

Timeline for d3oo0b_: