Lineage for d3p8mb_ (3p8m B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1902728Fold d.39: DLC [54647] (1 superfamily)
    core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342
  4. 1902729Superfamily d.39.1: DLC [54648] (1 family) (S)
    automatically mapped to Pfam PF01221
  5. 1902730Family d.39.1.1: DLC [54649] (3 proteins)
    8 kDa dynein light chain, DLC8
  6. 1902771Protein automated matches [190350] (4 species)
    not a true protein
  7. 1902774Species Human (Homo sapiens) [TaxId:9606] [196192] (1 PDB entry)
  8. 1902776Domain d3p8mb_: 3p8m B: [196193]
    automated match to d1re6a_

Details for d3p8mb_

PDB Entry: 3p8m (more details), 2.9 Å

PDB Description: Human dynein light chain (DYNLL2) in complex with an in vitro evolved peptide dimerized by leucine zipper
PDB Compounds: (B:) dynein light chain 2

SCOPe Domain Sequences for d3p8mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p8mb_ d.39.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
drkaviknadmsedmqqdavdcatqamekyniekdiaayikkefdkkynptwhcivgrnf
gsyvthetkhfiyfylgqvaillfksg

SCOPe Domain Coordinates for d3p8mb_:

Click to download the PDB-style file with coordinates for d3p8mb_.
(The format of our PDB-style files is described here.)

Timeline for d3p8mb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3p8ma_