SCOPe 2.08: Domain d3p8mb_: 3p8m B:

Lineage for d3p8mb_ (3p8m B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.39: DLC [54647] (1 superfamily)
   core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342

4. Superfamily d.39.1: DLC [54648] (1 family)
   automatically mapped to Pfam PF01221

5. Family d.39.1.1: DLC [54649] (3 proteins)
   8 kDa dynein light chain, DLC8

6. Protein automated matches [190350] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [196192] (2 PDB entries)

8. Domain d3p8mb_: 3p8m B: [196193]
   automated match to d1re6a_

Details for d3p8mb_

PDB Entry: 3p8m, 2.9 Å

PDB Description: Human dynein light chain (DYNLL2) in complex with an in vitro evolved peptide dimerized by leucine zipper

PDB Compounds: (B:) dynein light chain 2

SCOPe Domain Sequences for d3p8mb_:

Sequence; same for both SEQRES and ATOM records:

>d3p8mb_ d.39.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
drkaviknadmsedmqqdavdcatqamekyniekdiaayikkefdkkynptwhcivgrnf
gsyvthetkhfiyfylgqvaillfksg

Timeline for d3p8mb_:

• d3p8mb_ first appeared in SCOPe 2.02
  
• d3p8mb_ appears in SCOPe 2.07