Lineage for d3qvub_ (3qvu B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1163476Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 1163553Protein automated matches [190189] (4 species)
    not a true protein
  7. 1163561Species Human (Homo sapiens) [TaxId:9606] [186928] (10 PDB entries)
  8. 1163571Domain d3qvub_: 3qvu B: [196191]
    automated match to d1ls6a_
    complexed with a3p, edo, npo

Details for d3qvub_

PDB Entry: 3qvu (more details), 2.5 Å

PDB Description: Crystal structure of Ancestral variant b9 of SULT 1A1 in complex with PAP and p-nitrophenol
PDB Compounds: (B:) Sulfotransferase 1A1

SCOPe Domain Sequences for d3qvub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qvub_ c.37.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srqpleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsqildmiyqggdl
ekchrapifnrvpflefkapgipsgmetlkdtpaprllkthlplallpqtlldqkvkvvy
varnakdvavsyyhfyhmakvhpdpgtwdsflekfmvgevcygswyqhvqewwelsrthp
vlylfyedmkenpkreiqkilefvghslpeetvdfmvqhtsfkemkknpmtnyttipqei
mdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel

SCOPe Domain Coordinates for d3qvub_:

Click to download the PDB-style file with coordinates for d3qvub_.
(The format of our PDB-style files is described here.)

Timeline for d3qvub_: