SCOPe 2.06: Domain d1beoa_: 1beo A:

Lineage for d1beoa_ (1beo A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.134: Fungal elicitin [48646] (1 superfamily)
   5 helices: irregular disulfide-linked array; also contains a small beta-hairpin

4. Superfamily a.134.1: Fungal elicitin [48647] (1 family)
   automatically mapped to Pfam PF00964

5. Family a.134.1.1: Fungal elicitin [48648] (2 proteins)

6. Protein beta-cryptogein [48649] (1 species)

7. Species Phytophthora cryptogea [TaxId:4786] [48650] (4 PDB entries)

8. Domain d1beoa_: 1beo A: [19619]
   CASP2

Details for d1beoa_

PDB Entry: 1beo, 2.2 Å

PDB Description: beta-cryptogein

PDB Compounds: (A:) beta-cryptogein

SCOPe Domain Sequences for d1beoa_:

Sequence; same for both SEQRES and ATOM records:

>d1beoa_ a.134.1.1 (A:) beta-cryptogein {Phytophthora cryptogea [TaxId: 4786]}
tactatqqtaayktlvsilsdasfnqcstdsgysmltakalpttaqyklmcastacntmi
kkivtlnppncdltvptsglvlnvysyangfsnkcssl

Timeline for d1beoa_:

• d1beoa_ first appeared (with stable ids) in SCOP 1.55, called d1beo__
  
• d1beoa_ appears in SCOPe 2.05
  
• d1beoa_ appears in SCOPe 2.07
  
• d1beoa_ appears in the current release, SCOPe 2.08