SCOP 1.71: Domain d1beo__: 1beo -

Lineage for d1beo__ (1beo -)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.134: Fungal elicitin [48646] (1 superfamily)
   5 helices: irregular disulfide-linked array; also contains a small beta-hairpin

4. Superfamily a.134.1: Fungal elicitin [48647] (1 family)

5. Family a.134.1.1: Fungal elicitin [48648] (2 proteins)

6. Protein beta-cryptogein [48649] (1 species)

7. Species Phytophthora cryptogea [TaxId:4786] [48650] (4 PDB entries)

8. Domain d1beo__: 1beo - [19619]
   CASP2

Details for d1beo__

PDB Entry: 1beo, 2.2 Å

PDB Description: beta-cryptogein

SCOP Domain Sequences for d1beo__:

Sequence; same for both SEQRES and ATOM records:

>d1beo__ a.134.1.1 (-) beta-cryptogein {Phytophthora cryptogea}
tactatqqtaayktlvsilsdasfnqcstdsgysmltakalpttaqyklmcastacntmi
kkivtlnppncdltvptsglvlnvysyangfsnkcssl

Timeline for d1beo__:

• d1beo__ first appeared (with stable ids) in SCOP 1.55
  
• d1beo__ appears in SCOP 1.69
  
• d1beo__ is called d1beoa_ in SCOP 1.73
  
• d1beo__ appears in the current release, SCOPe 2.08, called d1beoa_