Lineage for d1beo__ (1beo -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 51390Fold a.134: Fungal elicitin, plant patogen [48646] (1 superfamily)
  4. 51391Superfamily a.134.1: Fungal elicitin, plant patogen [48647] (1 family) (S)
  5. 51392Family a.134.1.1: Fungal elicitin, plant patogen [48648] (1 protein)
  6. 51393Protein beta-cryptogein [48649] (1 species)
  7. 51394Species Phytophthora cryptogea [TaxId:4786] [48650] (3 PDB entries)
  8. 51396Domain d1beo__: 1beo - [19619]

Details for d1beo__

PDB Entry: 1beo (more details), 2.2 Å

PDB Description: beta-cryptogein

SCOP Domain Sequences for d1beo__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1beo__ a.134.1.1 (-) beta-cryptogein {Phytophthora cryptogea}
tactatqqtaayktlvsilsdasfnqcstdsgysmltakalpttaqyklmcastacntmi
kkivtlnppncdltvptsglvlnvysyangfsnkcssl

SCOP Domain Coordinates for d1beo__:

Click to download the PDB-style file with coordinates for d1beo__.
(The format of our PDB-style files is described here.)

Timeline for d1beo__: