Lineage for d1beoa_ (1beo A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733553Fold a.134: Fungal elicitin [48646] (1 superfamily)
    5 helices: irregular disulfide-linked array; also contains a small beta-hairpin
  4. 2733554Superfamily a.134.1: Fungal elicitin [48647] (1 family) (S)
    automatically mapped to Pfam PF00964
  5. 2733555Family a.134.1.1: Fungal elicitin [48648] (2 proteins)
  6. 2733564Protein beta-cryptogein [48649] (1 species)
  7. 2733565Species Phytophthora cryptogea [TaxId:4786] [48650] (4 PDB entries)
  8. 2733568Domain d1beoa_: 1beo A: [19619]
    CASP2

Details for d1beoa_

PDB Entry: 1beo (more details), 2.2 Å

PDB Description: beta-cryptogein
PDB Compounds: (A:) beta-cryptogein

SCOPe Domain Sequences for d1beoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1beoa_ a.134.1.1 (A:) beta-cryptogein {Phytophthora cryptogea [TaxId: 4786]}
tactatqqtaayktlvsilsdasfnqcstdsgysmltakalpttaqyklmcastacntmi
kkivtlnppncdltvptsglvlnvysyangfsnkcssl

SCOPe Domain Coordinates for d1beoa_:

Click to download the PDB-style file with coordinates for d1beoa_.
(The format of our PDB-style files is described here.)

Timeline for d1beoa_: