SCOPe 2.02: Domain d3s9ba_: 3s9b A:

Lineage for d3s9ba_ (3s9b A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein automated matches [190044] (13 species)
   not a true protein

7. Species Daboia russellii [TaxId:343250] [196182] (1 PDB entry)

8. Domain d3s9ba_: 3s9b A: [196183]
   automated match to d2aiqa_
   complexed with nag

Details for d3s9ba_

PDB Entry: 3s9b, 1.9 Å

PDB Description: russell's viper venom serine proteinase, rvv-v (open-form)

PDB Compounds: (A:) Vipera russelli proteinase RVV-V gamma

SCOPe Domain Sequences for d3s9ba_:

Sequence; same for both SEQRES and ATOM records:

>d3s9ba_ b.47.1.2 (A:) automated matches {Daboia russellii [TaxId: 343250]}
vvggdecninehpflvalytsasstihcagalinrewvltaahcdrrniriklgmhskni
rnedeqirvprgkyfclntkfpngldkdimlirlrrpvtysthiapvslpsrsrgvgsrc
rimgwgkistttypdvphctnifivkhkwceplypwvpadsrtlcagilkggrdtchgds
ggplicngemhgivaggsepcgqhlkpavytkvfdynnwiqsiiagnrtvtcpp

Timeline for d3s9ba_:

• d3s9ba_ is new in SCOPe 2.02-stable
  
• d3s9ba_ appears in SCOPe 2.03
  
• d3s9ba_ appears in the current release, SCOPe 2.08