SCOPe 2.06: Domain d3t7bb1: 3t7b B:1-257

Lineage for d3t7bb1 (3t7b B:1-257)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (2 proteins)

6. Protein automated matches [190527] (4 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [196169] (1 PDB entry)

8. Domain d3t7bb1: 3t7b B:1-257 [196170]
   Other proteins in same PDB: d3t7ba2, d3t7bb2
   automated match to d1gs5a_
   complexed with glu, srt

Details for d3t7bb1

PDB Entry: 3t7b, 2.5 Å

PDB Description: crystal structure of n-acetyl-l-glutamate kinase from yersinia pestis

PDB Compounds: (B:) acetylglutamate kinase

SCOPe Domain Sequences for d3t7bb1:

Sequence; same for both SEQRES and ATOM records:

>d3t7bb1 c.73.1.2 (B:1-257) automated matches {Yersinia pestis [TaxId: 214092]}
mnplviklggvlldseealerlftalvtyrekherplvimhgggclvdelmkrlalpvvk
knglrvtpadqidiitgalagtanktllawavkhqinavglcladgntvtvtlldaelgh
vgkaqpgsaalvqtllaagympiissigitvegqlmnvnadqaatalaatlgadlillsd
vsgildgkgqriaemtaqkaeqliaqgiitdgmvvkvnaaldaarslgrpvdiaswrhse
qlpalfngvpigtrisv

Timeline for d3t7bb1:

• d3t7bb1 first appeared in SCOPe 2.02, called d3t7bb_
  
• d3t7bb1 was called d3t7bb_ in SCOPe 2.05
  
• d3t7bb1 appears in SCOPe 2.07
  
• d3t7bb1 appears in the current release, SCOPe 2.08