![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
![]() | Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) ![]() the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
![]() | Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (2 proteins) |
![]() | Protein automated matches [190527] (4 species) not a true protein |
![]() | Species Yersinia pestis [TaxId:214092] [196169] (1 PDB entry) |
![]() | Domain d3t7bb1: 3t7b B:1-257 [196170] Other proteins in same PDB: d3t7ba2, d3t7bb2 automated match to d1gs5a_ complexed with glu, srt |
PDB Entry: 3t7b (more details), 2.5 Å
SCOPe Domain Sequences for d3t7bb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t7bb1 c.73.1.2 (B:1-257) automated matches {Yersinia pestis [TaxId: 214092]} mnplviklggvlldseealerlftalvtyrekherplvimhgggclvdelmkrlalpvvk knglrvtpadqidiitgalagtanktllawavkhqinavglcladgntvtvtlldaelgh vgkaqpgsaalvqtllaagympiissigitvegqlmnvnadqaatalaatlgadlillsd vsgildgkgqriaemtaqkaeqliaqgiitdgmvvkvnaaldaarslgrpvdiaswrhse qlpalfngvpigtrisv
Timeline for d3t7bb1: