Lineage for d3t7bb1 (3t7b B:1-257)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905127Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2905128Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2905147Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (2 proteins)
  6. 2905181Protein automated matches [190527] (4 species)
    not a true protein
  7. 2905202Species Yersinia pestis [TaxId:214092] [196169] (1 PDB entry)
  8. 2905204Domain d3t7bb1: 3t7b B:1-257 [196170]
    Other proteins in same PDB: d3t7ba2, d3t7bb2
    automated match to d1gs5a_
    complexed with glu, srt

Details for d3t7bb1

PDB Entry: 3t7b (more details), 2.5 Å

PDB Description: crystal structure of n-acetyl-l-glutamate kinase from yersinia pestis
PDB Compounds: (B:) acetylglutamate kinase

SCOPe Domain Sequences for d3t7bb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t7bb1 c.73.1.2 (B:1-257) automated matches {Yersinia pestis [TaxId: 214092]}
mnplviklggvlldseealerlftalvtyrekherplvimhgggclvdelmkrlalpvvk
knglrvtpadqidiitgalagtanktllawavkhqinavglcladgntvtvtlldaelgh
vgkaqpgsaalvqtllaagympiissigitvegqlmnvnadqaatalaatlgadlillsd
vsgildgkgqriaemtaqkaeqliaqgiitdgmvvkvnaaldaarslgrpvdiaswrhse
qlpalfngvpigtrisv

SCOPe Domain Coordinates for d3t7bb1:

Click to download the PDB-style file with coordinates for d3t7bb1.
(The format of our PDB-style files is described here.)

Timeline for d3t7bb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3t7bb2