Lineage for d1goda_ (1god A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015621Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2015622Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2015627Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2015739Protein Snake phospholipase A2 [48624] (38 species)
  7. 2015789Species Cerrophidion godmani, formerly Bothrops godmani [TaxId:44722] [48645] (1 PDB entry)
    Monomeric Lys-49 phospholipase A2 homologue
  8. 2015790Domain d1goda_: 1god A: [19617]

Details for d1goda_

PDB Entry: 1god (more details), 2.8 Å

PDB Description: monomeric lys-49 phospholipase a2 homologue isolated from the venom of cerrophidion (bothrops) godmani
PDB Compounds: (A:) protein (phospholipase a2)

SCOPe Domain Sequences for d1goda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1goda_ a.133.1.2 (A:) Snake phospholipase A2 {Cerrophidion godmani, formerly Bothrops godmani [TaxId: 44722]}
smyqlwkmilqetgknavpsyglygcncgvgsrgkpkdatdrccfvhkccykkltdcspk
tdsysyswkdktivcgdnnpclqemcecdkavaiclrenldtynknykiypkplckkada
c

SCOPe Domain Coordinates for d1goda_:

Click to download the PDB-style file with coordinates for d1goda_.
(The format of our PDB-style files is described here.)

Timeline for d1goda_: