SCOP 1.71: Domain d1goda_: 1god A:

Lineage for d1goda_ (1god A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (35 species)

7. Species Bothrops godmani [48645] (1 PDB entry)
   Monomeric Lys-49 phospholipase A2 homologue

8. Domain d1goda_: 1god A: [19617]

Details for d1goda_

PDB Entry: 1god, 2.8 Å

PDB Description: monomeric lys-49 phospholipase a2 homologue isolated from the venom of cerrophidion (bothrops) godmani

SCOP Domain Sequences for d1goda_:

Sequence; same for both SEQRES and ATOM records:

>d1goda_ a.133.1.2 (A:) Snake phospholipase A2 {Bothrops godmani}
smyqlwkmilqetgknavpsyglygcncgvgsrgkpkdatdrccfvhkccykkltdcspk
tdsysyswkdktivcgdnnpclqemcecdkavaiclrenldtynknykiypkplckkada
c

Timeline for d1goda_:

• d1goda_ first appeared (with stable ids) in SCOP 1.55
  
• d1goda_ appears in SCOP 1.69
  
• d1goda_ appears in SCOP 1.73
  
• d1goda_ appears in the current release, SCOPe 2.08