Lineage for d1goda_ (1god A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (2 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins) 
Protein Myotoxin II [48643] (2 species) 
Species Bothrops godmani [48645] (1 PDB entry) 
Domain d1goda_: 1god A: [19617]
Details for d1goda_
PDB Entry: 1god (more details), 2.8 Å
PDB Description: monomeric lys-49 phospholipase a2 homologue isolated from the venom of cerrophidion (bothrops) godmani
SCOP Domain Sequences for d1goda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1goda_ a.133.1.2 (A:) Myotoxin II {Bothrops godmani}
smyqlwkmilqetgknavpsyglygcncgvgsrgkpkdatdrccfvhkccykkltdcspk
tdsysyswkdktivcgdnnpclqemcecdkavaiclrenldtynknykiypkplckkada
c
SCOP Domain Coordinates for d1goda_:
Click to download the PDB-style file with coordinates for d1goda_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1goda_:
- d1goda_ appears in SCOP 1.57
- d1goda_ appears in the current release, SCOPe 2.08
View in 3D