Lineage for d3ovua_ (3ovu A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696840Superfamily a.7.11: Alpha-hemoglobin stabilizing protein AHSP [109751] (1 family) (S)
    the bundle twist angle is close to zero (small positive value); similar to the RRF alpha-helical bundle, (55194)
    automatically mapped to Pfam PF09236
  5. 2696841Family a.7.11.1: Alpha-hemoglobin stabilizing protein AHSP [109752] (1 protein)
    this is a repeat family; one repeat unit is 1w0a A: found in domain
  6. 2696842Protein Alpha-hemoglobin stabilizing protein AHSP [109753] (1 species)
  7. 2696843Species Human (Homo sapiens) [TaxId:9606] [109754] (7 PDB entries)
    Uniprot Q9NZD4 1-94
  8. 2696846Domain d3ovua_: 3ovu A: [196163]
    Other proteins in same PDB: d3ovub1, d3ovub2, d3ovuc_
    automated match to d1xzya_
    complexed with hem

Details for d3ovua_

PDB Entry: 3ovu (more details), 2.83 Å

PDB Description: Crystal Structure of Human Alpha-Haemoglobin Complexed with AHSP and the First NEAT Domain of IsdH from Staphylococcus aureus
PDB Compounds: (A:) Alpha-hemoglobin-stabilizing protein

SCOPe Domain Sequences for d3ovua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ovua_ a.7.11.1 (A:) Alpha-hemoglobin stabilizing protein AHSP {Human (Homo sapiens) [TaxId: 9606]}
lkankdlisaglkefsvllnqqvfndplvseedmvtvvedwmnfyinyyrqqvtgepqer
dkalqelrqelntlanpflakyrdflks

SCOPe Domain Coordinates for d3ovua_:

Click to download the PDB-style file with coordinates for d3ovua_.
(The format of our PDB-style files is described here.)

Timeline for d3ovua_: