Lineage for d1clpb_ (1clp B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6695Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
  4. 6696Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (2 families) (S)
  5. 6701Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins)
  6. 6705Protein Myotoxin II [48643] (2 species)
  7. 6708Species Terciopelo (Bothrops asper) [48644] (1 PDB entry)
  8. 6710Domain d1clpb_: 1clp B: [19616]

Details for d1clpb_

PDB Entry: 1clp (more details), 2.8 Å

PDB Description: crystal structure of a calcium-independent phospholipaselike myotoxic protein from bothrops asper venom

SCOP Domain Sequences for d1clpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clpb_ a.133.1.2 (B:) Myotoxin II {Terciopelo (Bothrops asper)}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennsclkelcecdkavaiclrenlntynkkyryylkplckkada
c

SCOP Domain Coordinates for d1clpb_:

Click to download the PDB-style file with coordinates for d1clpb_.
(The format of our PDB-style files is described here.)

Timeline for d1clpb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1clpa_