Lineage for d1clpa_ (1clp A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015621Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2015622Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2015627Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2015739Protein Snake phospholipase A2 [48624] (38 species)
  7. 2015991Species Terciopelo (Bothrops asper), myotoxin I [TaxId:8722] [48644] (2 PDB entries)
  8. 2015994Domain d1clpa_: 1clp A: [19615]

Details for d1clpa_

PDB Entry: 1clp (more details), 2.8 Å

PDB Description: crystal structure of a calcium-independent phospholipaselike myotoxic protein from bothrops asper venom
PDB Compounds: (A:) myotoxin II

SCOPe Domain Sequences for d1clpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clpa_ a.133.1.2 (A:) Snake phospholipase A2 {Terciopelo (Bothrops asper), myotoxin I [TaxId: 8722]}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennsclkelcecdkavaiclrenlntynkkyryylkplckkada
c

SCOPe Domain Coordinates for d1clpa_:

Click to download the PDB-style file with coordinates for d1clpa_.
(The format of our PDB-style files is described here.)

Timeline for d1clpa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1clpb_