![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
![]() | Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) ![]() |
![]() | Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins) |
![]() | Protein Snake phospholipase A2 [48624] (33 species) |
![]() | Species Terciopelo (Bothrops asper), myotoxin I [TaxId:8722] [48644] (1 PDB entry) |
![]() | Domain d1clpa_: 1clp A: [19615] |
PDB Entry: 1clp (more details), 2.8 Å
SCOP Domain Sequences for d1clpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1clpa_ a.133.1.2 (A:) Snake phospholipase A2 {Terciopelo (Bothrops asper), myotoxin I} slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk kdrysyswkdktivcgennsclkelcecdkavaiclrenlntynkkyryylkplckkada c
Timeline for d1clpa_: