SCOPe 2.02: Domain d3tqka_: 3tqk A:

Lineage for d3tqka_ (3tqk A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (32 species)
   not a true protein

7. Species Francisella tularensis [TaxId:119856] [196145] (1 PDB entry)

8. Domain d3tqka_: 3tqk A: [196146]
   automated match to d1kfla_
   complexed with act, ca, mn

Details for d3tqka_

PDB Entry: 3tqk, 2.3 Å

PDB Description: Structure of Phospho-2-dehydro-3-deoxyheptonate aldolase from Francisella tularensis SCHU S4

PDB Compounds: (A:) phospho-2-dehydro-3-deoxyheptonate aldolase

SCOPe Domain Sequences for d3tqka_:

Sequence; same for both SEQRES and ATOM records:

>d3tqka_ c.1.10.0 (A:) automated matches {Francisella tularensis [TaxId: 119856]}
nikkekvlipaevliqdipllktsfetvrksrkeianiihgnddrvavvvgpcsihdpaa
aieyatklkeqvkkfhkdiliimrvyfekprttigwkgfindpdldnsyninkglrlarn
llsdltnmglpcatefldvitpqyfaelitwgaigartvesqvhrelasglsasigfkna
tngdvqvavdavksatyphhflsttksgstaifatkgnqnghvilrggasgpnfskehvd
dciaklkkadintkvmidcshgnsqkdhskqisvladiceqikhsndifgvmiesnlvag
nqdinkkpltygqsvtdkcvdfeetvkmlemlaeavqvrrg

Timeline for d3tqka_:

• d3tqka_ is new in SCOPe 2.02-stable
  
• d3tqka_ appears in SCOPe 2.03
  
• d3tqka_ appears in the current release, SCOPe 2.08