Lineage for d3tqfb_ (3tqf B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143071Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 2143072Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 2143188Family c.91.1.0: automated matches [196141] (1 protein)
    not a true family
  6. 2143189Protein automated matches [196142] (6 species)
    not a true protein
  7. 2143211Species Coxiella burnetii [TaxId:777] [196143] (1 PDB entry)
  8. 2143213Domain d3tqfb_: 3tqf B: [196144]
    automated match to d1kklc_
    complexed with po4

Details for d3tqfb_

PDB Entry: 3tqf (more details), 2.8 Å

PDB Description: structure of the hpr(ser) kinase/phosphatase from coxiella burnetii
PDB Compounds: (B:) Hpr(Ser) kinase

SCOPe Domain Sequences for d3tqfb_:

Sequence, based on SEQRES records: (download)

>d3tqfb_ c.91.1.0 (B:) automated matches {Coxiella burnetii [TaxId: 777]}
kqtwhanflvidkmgvlitgeanigkselslalidrghqlvcddvidlkqennqligscp
svangyilitgigiidvpklfgldavvnqhevhlsislvkpekmpllddplnplyrteii
lginvpkilfpihpgrnlpllietlvrnhrlkmeg

Sequence, based on observed residues (ATOM records): (download)

>d3tqfb_ c.91.1.0 (B:) automated matches {Coxiella burnetii [TaxId: 777]}
kqtwhanflvidkmgvlitgeanigkselslalidrghqlvcddvidlkqennqligscp
svangyilitgigiidvpklfgldavvnqhevhlsislvkpekmpldplnplyrteiilg
invpkilfpihnlpllietlvrnhrlkmeg

SCOPe Domain Coordinates for d3tqfb_:

Click to download the PDB-style file with coordinates for d3tqfb_.
(The format of our PDB-style files is described here.)

Timeline for d3tqfb_: