Lineage for d1buna_ (1bun A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 51243Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
  4. 51244Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 51249Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins)
  6. 51250Protein beta2-bungarotoxin, phospholipase A2 chain [48641] (1 species)
  7. 51251Species Many-banded krait (Bungarus multicinctus), elapid [48642] (1 PDB entry)
  8. 51252Domain d1buna_: 1bun A: [19614]
    Other proteins in same PDB: d1bunb_

Details for d1buna_

PDB Entry: 1bun (more details), 2.45 Å

PDB Description: structure of beta2-bungarotoxin: potassium channel binding by kunitz modules and targeted phospholipase action

SCOP Domain Sequences for d1buna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1buna_ a.133.1.2 (A:) beta2-bungarotoxin, phospholipase A2 chain {Many-banded krait (Bungarus multicinctus), elapid}
nlinfmemirytipcektwgeyadygcycgaggsgrpidaldrccyvhdncygdaekkhk
cnpktqsysykltkrtiicygaagtcarivcdcdrtaalcfgnseyieghknidtarfcq

SCOP Domain Coordinates for d1buna_:

Click to download the PDB-style file with coordinates for d1buna_.
(The format of our PDB-style files is described here.)

Timeline for d1buna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bunb_