Lineage for d1buna_ (1bun A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733039Protein Snake phospholipase A2 [48624] (38 species)
  7. 2733188Species Many-banded krait (Bungarus multicinctus), beta2-bungarotoxin [TaxId:8616] [48642] (1 PDB entry)
  8. 2733189Domain d1buna_: 1bun A: [19614]
    Other proteins in same PDB: d1bunb_
    complexed with na

Details for d1buna_

PDB Entry: 1bun (more details), 2.45 Å

PDB Description: structure of beta2-bungarotoxin: potassium channel binding by kunitz modules and targeted phospholipase action
PDB Compounds: (A:) beta2-bungarotoxin

SCOPe Domain Sequences for d1buna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1buna_ a.133.1.2 (A:) Snake phospholipase A2 {Many-banded krait (Bungarus multicinctus), beta2-bungarotoxin [TaxId: 8616]}
nlinfmemirytipcektwgeyadygcycgaggsgrpidaldrccyvhdncygdaekkhk
cnpktqsysykltkrtiicygaagtcarivcdcdrtaalcfgnseyieghknidtarfcq

SCOPe Domain Coordinates for d1buna_:

Click to download the PDB-style file with coordinates for d1buna_.
(The format of our PDB-style files is described here.)

Timeline for d1buna_: