![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
![]() | Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
![]() | Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
![]() | Protein Snake phospholipase A2 [48624] (38 species) |
![]() | Species Many-banded krait (Bungarus multicinctus), beta2-bungarotoxin [TaxId:8616] [48642] (1 PDB entry) |
![]() | Domain d1buna_: 1bun A: [19614] Other proteins in same PDB: d1bunb_ complexed with na |
PDB Entry: 1bun (more details), 2.45 Å
SCOPe Domain Sequences for d1buna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1buna_ a.133.1.2 (A:) Snake phospholipase A2 {Many-banded krait (Bungarus multicinctus), beta2-bungarotoxin [TaxId: 8616]} nlinfmemirytipcektwgeyadygcycgaggsgrpidaldrccyvhdncygdaekkhk cnpktqsysykltkrtiicygaagtcarivcdcdrtaalcfgnseyieghknidtarfcq
Timeline for d1buna_: