Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.0: automated matches [191350] (1 protein) not a true family |
Protein automated matches [190292] (20 species) not a true protein |
Species Coxiella burnetii [TaxId:777] [196137] (1 PDB entry) |
Domain d3tr2b_: 3tr2 B: [196139] automated match to d1eixa_ |
PDB Entry: 3tr2 (more details), 2 Å
SCOPe Domain Sequences for d3tr2b_:
Sequence, based on SEQRES records: (download)
>d3tr2b_ c.1.2.0 (B:) automated matches {Coxiella burnetii [TaxId: 777]} dpkvivaidagtveqaraqinpltpelchlkigsilftrygpafveelmqkgyrifldlk fydipqtvagacravaelgvwmmnihisggrtmmetvvnalqsitlkekplligvtilts ldgsdlktlgiqekvpdivcrmatlaksagldgvvcsaqeaallrkqfdrnfllvtpgir letdekgdqkrvmtpraaiqagsdylvigrpitqstdplkaleaidkdiktr
>d3tr2b_ c.1.2.0 (B:) automated matches {Coxiella burnetii [TaxId: 777]} dpkvivaidagtveqaraqinpltpelchlkigsilftrygpafveelmqkgyrifldlk fydipqtvagacravaelgvwmmnihisggrtmmetvvnalqsitlkekplligvtilts ldgsdlktlgiqekvpdivcrmatlaksagldgvvcsaqeaallrkqfdrnfllvtpgir lmtpraaiqagsdylvigrpitqstdplkaleaidkdiktr
Timeline for d3tr2b_: