SCOPe 2.05: Domain d3trrf_: 3trr F:

Lineage for d3trrf_ (3trr F:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (49 species)
   not a true protein

7. Species Mycobacterium abscessus [TaxId:561007] [189671] (6 PDB entries)

8. Domain d3trrf_: 3trr F: [196138]
   automated match to d3r0ob_
   complexed with edo, gol, peg

Details for d3trrf_

PDB Entry: 3trr, 2.09 Å

PDB Description: crystal structure of a probable enoyl-coa hydratase/isomerase from mycobacterium abscessus

PDB Compounds: (F:) Probable enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d3trrf_:

Sequence; same for both SEQRES and ATOM records:

>d3trrf_ c.14.1.0 (F:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
adevlieqrdrvllitinrpdarnavnravsqglaaaadqldssadlsvaiitgaggnfc
agmdlkafvsgeavlserglgftnvpprkpiiaavegfalaggtelvlscdlvvagrsak
fgipevkrglvagaggllrlpnripyqvamelaltgesftaedaakygfinrlvddgqal
dtalelaakitangplavaatkriiiesaswapeeafakqgeilmpifvsedakegakaf
aekrapvwqgk

Timeline for d3trrf_:

• d3trrf_ first appeared in SCOPe 2.02
  
• d3trrf_ appears in SCOPe 2.04
  
• d3trrf_ appears in SCOPe 2.06
  
• d3trrf_ appears in the current release, SCOPe 2.08