Lineage for d3trfb_ (3trf B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1366119Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1366120Protein automated matches [190123] (58 species)
    not a true protein
  7. 1366180Species Coxiella burnetii [TaxId:777] [196130] (3 PDB entries)
  8. 1366185Domain d3trfb_: 3trf B: [196136]
    automated match to d1kaga_
    complexed with so4

Details for d3trfb_

PDB Entry: 3trf (more details), 2.6 Å

PDB Description: structure of a shikimate kinase (arok) from coxiella burnetii
PDB Compounds: (B:) Shikimate kinase

SCOPe Domain Sequences for d3trfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3trfb_ c.37.1.0 (B:) automated matches {Coxiella burnetii [TaxId: 777]}
tniyliglmgagktsvgsqlakltkrilydsdkeiekrtgadiawifemegeagfrrrer
emiealckldniilatgggvvldeknrqqisetgvviyltasidtqlkrigqkgemrrpl
fiknnskeklqqlneirkplyqamadlvyptddlnprqlatqilvdik

SCOPe Domain Coordinates for d3trfb_:

Click to download the PDB-style file with coordinates for d3trfb_.
(The format of our PDB-style files is described here.)

Timeline for d3trfb_: