Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Coxiella burnetii [TaxId:777] [196130] (3 PDB entries) |
Domain d3trfb_: 3trf B: [196136] automated match to d1kaga_ complexed with so4 |
PDB Entry: 3trf (more details), 2.6 Å
SCOPe Domain Sequences for d3trfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3trfb_ c.37.1.0 (B:) automated matches {Coxiella burnetii [TaxId: 777]} tniyliglmgagktsvgsqlakltkrilydsdkeiekrtgadiawifemegeagfrrrer emiealckldniilatgggvvldeknrqqisetgvviyltasidtqlkrigqkgemrrpl fiknnskeklqqlneirkplyqamadlvyptddlnprqlatqilvdik
Timeline for d3trfb_: