SCOPe 2.02: Domain d3tr7a_: 3tr7 A:

Lineage for d3tr7a_ (3tr7 A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)

6. Protein automated matches [190540] (3 species)
   not a true protein

7. Species Coxiella burnetii [TaxId:777] [196132] (1 PDB entry)

8. Domain d3tr7a_: 3tr7 A: [196133]
   automated match to d2jhqa_

Details for d3tr7a_

PDB Entry: 3tr7, 2.2 Å

PDB Description: structure of a uracil-dna glycosylase (ung) from coxiella burnetii

PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d3tr7a_:

Sequence; same for both SEQRES and ATOM records:

>d3tr7a_ c.18.1.1 (A:) automated matches {Coxiella burnetii [TaxId: 777]}
tqtwqtvlgeekqepyfqeildfvkkerkagkiiyppqkdifnalkltpyeaikvvilgq
dpyhgpnqahglafsvrpgvpappslqnifkelhadlgvsipshgflekwakqgvlllna
altveagkpqshanigwhrftdkvieslndhpegivfllwgsyaqkksqlitnlrhrilk
aphpsplsaargflgcrhfskanqllhemgrgeidwald

Timeline for d3tr7a_:

• d3tr7a_ is new in SCOPe 2.02-stable
  
• d3tr7a_ appears in SCOPe 2.03
  
• d3tr7a_ appears in the current release, SCOPe 2.08